PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491827.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 155aa    MW: 17926.9 Da    PI: 10.0572
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491827.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.4e-221053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    r e +snrqvt++k r gilKKA+E+SvLCd+++++++fs+tgk
  XP_016491827.1 10 RLETSSNRQVTYCKKRSGILKKAKEISVLCDIDILLLMFSPTGK 53
                    67899**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.46161IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-26160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-181256IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGRVRINIRR LETSSNRQVT YCKKRSGILK KAKEISVLCD IDILLLMFSP TGKPTLFQGE  60
RSNFDEIIAK FAQLTPQERA KRKLESLETL RKTFKKLDQD VGVQEFLDAS DPSVEELNNQ  120
VKVLQSRLTD VEKRLRYSCA FLCFSFFIFG VQMLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-15192190Myocyte-specific enhancer factor 2B
1tqe_Q2e-15192190Myocyte-specific enhancer factor 2B
1tqe_R2e-15192190Myocyte-specific enhancer factor 2B
1tqe_S2e-15192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491827.11e-110PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ7X9I01e-58AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLK4BL939e-70K4BL93_SOLLC; Uncharacterized protein
STRINGSolyc03g115910.1.13e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76402124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.18e-60AGAMOUS-like 65